SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000039017 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000039017
Domain Number 1 Region: 23-65
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000028
Family EGF-type module 0.01
Further Details:      
 
Domain Number 2 Region: 60-101
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000303
Family EGF-type module 0.0077
Further Details:      
 
Domain Number 3 Region: 8-30
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000047
Family EGF-type module 0.022
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000039017
Domain Number - Region: 101-123
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000205
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000039017   Gene: ENSMODG00000029701   Transcript: ENSMODT00000042126
Sequence length 124
Comment pep:novel chromosome:BROADO5:2:314182574:314295966:-1 gene:ENSMODG00000029701 transcript:ENSMODT00000042126 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLDNFPLGFKCQCVKGFAGPQCEININECSSNPCLNGYCYDIVDGFSCLCNPGYAGLRC
EQTIDDCITHACENNSTCQDLHLNYKCICLPGWEGTFCDRETNECSIEPCENNSTCIDLF
NGYQ
Download sequence
Identical sequences K7DZR6
ENSMODP00000039017 ENSMODP00000039017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]