SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000039043 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000039043
Domain Number 1 Region: 201-301
Classification Level Classification E-value
Superfamily HIN-2000 domain-like 1.46e-37
Family HIN-200/IF120x domain 0.00011
Further Details:      
 
Domain Number 2 Region: 302-394
Classification Level Classification E-value
Superfamily HIN-2000 domain-like 4.18e-26
Family HIN-200/IF120x domain 0.00091
Further Details:      
 
Domain Number 3 Region: 33-108
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000000789
Family Pyrin domain, PYD 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000039043   Gene: ENSMODG00000027491   Transcript: ENSMODT00000042153
Sequence length 398
Comment pep:novel chromosome:BROADO5:2:167073463:167097600:-1 gene:ENSMODG00000027491 transcript:ENSMODT00000042153 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQFKITKRQLMMKLGRRTVIGLKSTEEMNKKFGEILLSGLEELQNEDFKKFKFFLSNDCL
MMRVHNLDRIDLATCMKKQLPCPSFMNKFIEILKKMNLNETAKKYKEQKEEVLKKLKKEN
EKKPTKRKNQAQTRKPSDGKNSVNPQLTKKDSLKLNDESKKNCGAKRTKATTEEKPESKK
RKLSEVSHQKTEPETGREDGPQTMPVVMKVLKVKEIFEYETKEKTKTMFHATVANEHEFI
RVKVLNIDVKEYFNQKNVIEISEGFWKSGFLEVNKSSKVIDLGANREMEVPQNIIRKASQ
TPKIQSLLKLKNKKERIYVDGVYEINKKTETDKCTIFVVKDNTGTIKVVTFGKWAKIKCD
ERDKLRLTCFELCVWDVKDEIQLKSVTHSYVKVIKAKK
Download sequence
Identical sequences K7DZU2
ENSMODP00000039043 ENSMODP00000039043 XP_016285767.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]