SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000039077 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000039077
Domain Number - Region: 28-51
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000502
Family Laminin-type module 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000039077   Gene: ENSMODG00000029117   Transcript: ENSMODT00000042187
Sequence length 512
Comment pep:novel chromosome:BROADO5:Un:75974327:75980132:1 gene:ENSMODG00000029117 transcript:ENSMODT00000042187 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAREDPERYPLSPEEIEKWVSEGPSEDEAVCVNCQNNSYGDKCQRCLEGYFLLDGRCTKC
QCNGHADTCNEDGTGCPCQNNTETGTCQGSSPSDRRDCYKYQCAKCRESFHGSPLGGQQC
YRLISVEQECCLDPTSQTNCFHEPKRRALGPGRTVLFGVQPKFTNVDIRLTLDVTFGAVD
LYVSTSYDTFVVRVDPDTGIHSVHIQPPPPAPPPVAAEAGLRAGEAGAGGPGAPPEPRIR
EVRPRGLITYVTVIEPAAVLVVRGVRDRLVITYPHEQHALKSSRFYLLLLGVGDPTAPGA
NGSADSQGLLFFRQDQAHIDLFVFFSVFFSCFFLFLSLCVLLWKAKQALDQRREQRRHLQ
EMTKMASRPFAKVTVCFPPEPAVTVPWKTTSVGLPPPAFRRSEPFLAPLLLTGGGGPWGA
GSGGCCPVALRAGPITLEPTEDGMAGVATLLLQLPGGIYTPNRACLGSALVTLRHRLQEY
CGGGSGPGASGHGAGGGRKGLLTHDNLTSMSL
Download sequence
Identical sequences K7DZX6
XP_007505588.1.35504 ENSMODP00000039077 ENSMODP00000039077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]