SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000039090 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000039090
Domain Number 1 Region: 26-507
Classification Level Classification E-value
Superfamily Cytochrome P450 6.42e-62
Family Cytochrome P450 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000039090   Gene: ENSMODG00000028520   Transcript: ENSMODT00000042200
Sequence length 508
Comment pep:novel chromosome:BROADO5:6:200206528:200208054:1 gene:ENSMODG00000028520 transcript:ENSMODT00000042200 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALWASVLIVLVAIVLIGLYKLGALRQRKAREPPLDKGPIPWLGYSKEFSKDASIFLKKM
QERHGDIFTVQLCGRYVTFVTDPFTYDAILKESKDKLGFSNLVSEKVIKIFDIQYEEGHQ
KISSNIHTKHLSASSLVVITQAVMDNLQTLLLEPDGGIRPASQEWKQDGLLEYCYSVIFR
AGYLALFGSFPTSGKTGRIQDLLHSQKVFQEFRKFDRLFPRAFYSILHPKEKQEMKRLRH
FFWDILSSQQILEKDNVSSWIHSIQQEMIENGVSDKGQSQNNLVLLWASQGSTTGVNFWT
LFFLLKNPEALKAVREEAEGILRKMGKEKRPGGVPINFDYNMLKQTPVLDSVMEETLRLV
VAPFLARSVMQDMTLKMDDGREYALRKGDEVCVFPYLFLHMDPEIHSDPTTFKYDRFLTL
DGSQKVVFYKQGRRIKSHMLPWGAGTTLCPGRFLALNQIKMFIFLMVTQYDMELVDQEAG
IPPINVKRWGMGPLQPMYDVQFRYRLRF
Download sequence
Identical sequences K7DZY9
ENSMODP00000039090 XP_001377104.2.35504 ENSMODP00000039090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]