SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000039136 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000039136
Domain Number - Region: 23-108
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000228
Family Myosin rod fragments 0.0069
Further Details:      
 
Domain Number - Region: 155-200
Classification Level Classification E-value
Superfamily RING/U-box 0.0101
Family U-box 0.096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000039136   Gene: ENSMODG00000029509   Transcript: ENSMODT00000042245
Sequence length 214
Comment pep:novel chromosome:BROADO5:2:201497598:201507000:1 gene:ENSMODG00000029509 transcript:ENSMODT00000042245 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKQKDTTANRKQQEFTGPRDKKAPVEKQLVQEVERLKSKVEAGRACFIEKYKECQRLHKQ
IRQLKAAVLNQISDLMKRLDESKFFYQELQKEKTRVEGEKDLLQKENERLLCYVCNDSGS
NLLSNPIPVQEALEENTGLVFGNPYAAAQDIQYIPILPSIKKCPICHGVFPDDVEENVFE
QHLQTHILDCPFCDEVFSEAERQVYDDHVFCHSL
Download sequence
Identical sequences K7E035
ENSMODP00000039136 ENSMODP00000039136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]