SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000039255 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000039255
Domain Number 1 Region: 145-180
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000111
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000039255   Gene: ENSMODG00000028423   Transcript: ENSMODT00000042365
Sequence length 189
Comment pep:novel chromosome:BROADO5:7:234249622:234370044:-1 gene:ENSMODG00000028423 transcript:ENSMODT00000042365 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQPSSAWHSDHPNLPGSITLSWGQPLRAATMTRHRLGLWCVSCWLAVLWPLHSCLQLRK
GMPNVCEEEVLGMVGLPQPCVQPFTRTMRLWKQGCSGPRWCMEYKRRTGYYTVYRQVYSM
QHQTVYRCCPGWSQQEHEPGCLHALCSVGPCFNGGQCLDGEAQMCQCPVGFQGPRCQYDA
ETKRQKKVM
Download sequence
Identical sequences K7E0F4
ENSMODP00000039255 ENSMODP00000039255

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]