SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000039501 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000039501
Domain Number 1 Region: 13-159
Classification Level Classification E-value
Superfamily ARM repeat 0.0000643
Family HspBP1 domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000039501   Gene: ENSMODG00000028734   Transcript: ENSMODT00000042607
Sequence length 161
Comment pep:novel chromosome:BROADO5:Un:28:20750:-1 gene:ENSMODG00000028734 transcript:ENSMODT00000042607 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRVKPRKAQNAQQLHERIQSSSMDAKLEALKDLASYSRDITFAQEFINLDGISLLTQMV
ESGTERYQKLQKIMKPCFGDMLSFTLTAFVELMDHGIVSWDTFSVAFIKKIASFVNKAAI
DLSILQRSLAILESMVLNSHDLYQKVAQEITIGQLIPHLQG
Download sequence
Identical sequences K7E150
ENSMODP00000039501 ENSMODP00000039501

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]