SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000039551 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000039551
Domain Number 1 Region: 383-467
Classification Level Classification E-value
Superfamily DEATH domain 2.73e-18
Family DEATH domain, DD 0.0000434
Further Details:      
 
Domain Number 2 Region: 132-170
Classification Level Classification E-value
Superfamily TNF receptor-like 2.28e-16
Family TNF receptor-like 0.00016
Further Details:      
 
Domain Number 3 Region: 153-212
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00000000000706
Family TNF receptor-like 0.00012
Further Details:      
 
Domain Number 4 Region: 79-130
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000000275
Family TNF receptor-like 0.00016
Further Details:      
 
Domain Number 5 Region: 213-236
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00000000497
Family TNF receptor-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000039551   Gene: ENSMODG00000012200   Transcript: ENSMODT00000042657
Sequence length 476
Comment pep:novel chromosome:BROADO5:2:202487503:202518340:1 gene:ENSMODG00000012200 transcript:ENSMODT00000042657 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGPYRLLLMLLLLLLGRQKIKQDFGSPPTPHPQENLVLNCSYPWPKMLRRQESDSPFPW
ILSCSKCLSVSMGEVKEDCATDLYTDSGECCRACNQGEGVAQPCGVNQTVCEPCLDSVTF
SDTVSATEACKPCTECVGLQSMSAPCVEADDAVCRCAYGYYQDEESGICKPCSVCEPGSG
LVFSCQDKQNTVCEVCPEGTYSDEANHVDPCLPCTACEETEREIRECTRWSDRECEEIPA
RWIPRTTTTTIVGSESPAPVTQEPPEPPEPEAEASTVADVVTTVMGSSQPVVTRGTTDNL
IPVYCSILAAVVVGLLAYIVFKRWNSCKQNKQGANNRPVNQTPSPEGEKLHSDSGISVDS
QSLHDQQPQTQTAQVQALKGDGGLYSNLPAAKREEVEKLLNSSSEETWRHLAGELGYLPE
RIDSLTREDYPVRALLDSWAAQDSATLDALYAALRRIQRGDIVENLYSESTATSPV
Download sequence
Identical sequences K7E1A0
ENSMODP00000039551 ENSMODP00000039551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]