SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000039670 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000039670
Domain Number - Region: 44-186
Classification Level Classification E-value
Superfamily Cytochrome P450 0.0271
Family Cytochrome P450 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000039670   Gene: ENSMODG00000029198   Transcript: ENSMODT00000042776
Sequence length 190
Comment pep:novel chromosome:BROADO5:2:66079981:66084759:1 gene:ENSMODG00000029198 transcript:ENSMODT00000042776 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFIQGLSLIIPLWSVCFVKESFCFCAKPTWARVGWEIFPGEVDLKHLTSAQTSSMHDFLS
KWRQNSWSCTQVSSVLVEILFIILTVLSGHYLWTKRKKHPRKPEDRMSSSYDQQNQSIYD
IDQILCRLMSTTSLLTRYLKHVSEHPPKKFRHRRKSRKKRDGGDMLNWDLHMCTHGDSNP
SSIDNIDGDY
Download sequence
Identical sequences K7E1L9
ENSMODP00000039670 ENSMODP00000039670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]