SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000039722 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000039722
Domain Number 1 Region: 113-180
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000000765
Family DEATH domain, DD 0.0066
Further Details:      
 
Domain Number 2 Region: 4-80
Classification Level Classification E-value
Superfamily DEATH domain 0.000000000236
Family Pyrin domain, PYD 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000039722   Gene: ENSMODG00000028298   Transcript: ENSMODT00000042827
Sequence length 198
Comment pep:novel chromosome:BROADO5:8:34900071:34904767:1 gene:ENSMODG00000028298 transcript:ENSMODT00000042827 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNQEIQILEVLRDLEDAEFKTFKKILSQEEVRASTWALPSTSREDITNQLLKYYGSEARN
VVAQILYRVPALHLLEKLGELRLEDAAQGQQSSIPCTRRQPPIGLAEPVVSQEKLMKLSQ
HVGHEWRTLGIMCLGLQQHQLERLEEDNPSTVMRIFNMFQLWRNQERKNATVTRLYQLLS
QGSIPISPEALDVLLEGT
Download sequence
Identical sequences K7E1S1
ENSMODP00000039722 ENSMODP00000039722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]