SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000039769 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000039769
Domain Number 1 Region: 5-18,45-163
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000432
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 2 Region: 175-225
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00000777
Family TNF receptor-like 0.023
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000039769
Domain Number - Region: 302-429
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000267
Family Growth factor receptor domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000039769   Gene: ENSMODG00000028323   Transcript: ENSMODT00000042874
Sequence length 438
Comment pep:novel chromosome:BROADO5:4:287664560:287684358:1 gene:ENSMODG00000028323 transcript:ENSMODT00000042874 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNDQPANCTSCPPGAYCPSGSPKPVFCPGGTFQVHPGAQMIGDCALCPEGHHCPELGTM
TPVPCAAGSYSSSGQLLCQECPEGKFCNGTGVAEPSVCPPGHYCPAKSILPNPCPVGTFR
EAPGATSMDLCQPCCPGRFCSKTGLKEPEGLCDPGYYCGPGSNTSSPVGFSFGDFCPKGH
YCPAGTADTEQTPCPAGTWNKKKGAQDASWCLSCPPGFFCDVAGSAAPGGPCAPGFFCTG
GTQTPRPVGGAGGDLCPTGHACPEGSSFAIPCLDGQHSNGTGQKSCLPCPAGSYCPGGQK
KLCPPGSYCPKGTGSSPCPCPPGTFGPFLGLSQMQDCQPCPAGMFCEEQGLKSPSGPCQS
GFFCSGGSNIANPDGVSTNKGGPCPPGHFCPAGTSAPLPCPMGTFSDRHFLSEVSECLAC
PPGLFCGSSGLSAPSGPC
Download sequence
Identical sequences K7E1W8
ENSMODP00000039769 ENSMODP00000039769

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]