SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000039857 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000039857
Domain Number 1 Region: 196-310
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000233
Family Myosin rod fragments 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000039857   Gene: ENSMODG00000028850   Transcript: ENSMODT00000042962
Sequence length 379
Comment pep:novel chromosome:BROADO5:8:249941132:250000094:1 gene:ENSMODG00000028850 transcript:ENSMODT00000042962 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAETETVGLLEVPVVEPVSSSIGREESWGPAPEVGRCMKSAVQPLLEPLDFCQSYYRGSI
SDDLKIGFFATDRATQTDITEILEIKQLVDKTRKLVTLTDILHHDFKSLKIFLEMQFDDC
LKLESMKLFRKLQTIIDEIRLLHEKNEATMRQSFYKQLCDAIASIKGNYMQYFEMEPEQG
KVQGVSLSVLRKKIQEKNKIIEDLKEELSLYKQNEIYKLEFMKEECNDKISNLEKDISGL
RKENEKLQKSITELEDDLQLCEKTNMLLEGEIMAMKQRMEEDQRLITKLTSMKDRLSVDL
DHEKEAVQEMIEQQKKEIKETKKVLAVPRLIAKAPTDARRATEDRGMIVRKIPVSQGNSN
SPTPSWLEGSDNSLQTMGA
Download sequence
Identical sequences K7E256
ENSMODP00000039857 ENSMODP00000039857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]