SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000039975 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000039975
Domain Number 1 Region: 3-83
Classification Level Classification E-value
Superfamily Cytochrome P450 0.0000000000151
Family Cytochrome P450 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000039975   Gene: ENSMODG00000029715   Transcript: ENSMODT00000043079
Sequence length 125
Comment pep:novel chromosome:BROADO5:Un:81975798:82002724:1 gene:ENSMODG00000029715 transcript:ENSMODT00000043079 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLKNFGLGKKTLELRIQEEAIYFIEAIREEKGQPFDPHFQINNAVSNIICSVTFGNRFE
YHDSKFQELLKSLNQVSVLQSRWECKVNRPLSLLNRAKFALDGWCPPFTRKETSKPVRGW
QELRL
Download sequence
Identical sequences K7E2H4
ENSMODP00000039975 ENSMODP00000039975

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]