SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000039979 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000039979
Domain Number 1 Region: 27-62
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.000000000115
Family Intermediate filament protein, coiled coil region 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000039979
Domain Number - Region: 65-97
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0549
Family Pan module (APPLE domain) 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000039979   Gene: ENSMODG00000028860   Transcript: ENSMODT00000043083
Sequence length 112
Comment pep:novel chromosome:BROADO5:2:195334607:195337703:1 gene:ENSMODG00000028860 transcript:ENSMODT00000043083 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSLPGAHNIPASAGIGSWFGDIALNGSEKETMRFLNDRLANYLEKVRRLEQQNAELEGK
IKEWSQCQVPNMCSNYTSYFKTIHELQCKLLCSKAENSKLAVQVDNAKLATD
Download sequence
Identical sequences K7E2H8
ENSMODP00000039979 ENSMODP00000039979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]