SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000040041 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000040041
Domain Number 1 Region: 302-421
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-32
Family Cadherin 0.0012
Further Details:      
 
Domain Number 2 Region: 515-642
Classification Level Classification E-value
Superfamily Cadherin-like 5.23e-29
Family Cadherin 0.003
Further Details:      
 
Domain Number 3 Region: 416-519
Classification Level Classification E-value
Superfamily Cadherin-like 2.22e-24
Family Cadherin 0.0031
Further Details:      
 
Domain Number 4 Region: 199-306
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-23
Family Cadherin 0.0054
Further Details:      
 
Domain Number 5 Region: 631-736
Classification Level Classification E-value
Superfamily Cadherin-like 1.07e-17
Family Cadherin 0.0027
Further Details:      
 
Domain Number 6 Region: 102-176
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000728
Family Cadherin 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000040041   Gene: ENSMODG00000029307   Transcript: ENSMODT00000043144
Sequence length 974
Comment pep:novel chromosome:BROADO5:1:332637457:332900773:1 gene:ENSMODG00000029307 transcript:ENSMODT00000043144 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNDGGFSRIDLKESENNIYLYSLKMIHLLEQFHGGSAMFFSRVGGLGSRHLLFSFMLCTA
CEVGSSQVHYSVLEEAKHGTFVGRIAQDLGLEVGELVSKLFQVHYSVLEEAKHGTFVGRI
AQDLGLEVGELVSKLFQVVSKGRRDYLEVNGQNGVLFVNSRIDREELCGRSLVCSIHLEV
IVDKPLQVFHVEVDIKDINDNPPVFPVKEQKLFIYESRLPDSRFPLEGASDPDIGTNALL
TYSLSTNDYFILDVKSKNEQDKLVELVLRKPLDREEVPEHHLILTVTDGGKPELTGTVQL
LITVLDVNDNAPTFERSEYEVKILENAARGTLVIQLNASDADEGINGEIVYSFNSLASPL
INDKFQINPDTGEISIQRYLDFEDINSYKFRVDATDKGNPPMVGHCTIRVDVEDTNDNAP
ELSVTSLSLPVREDAPPGTVIALISVSDRDSGANGLVTCFLSPPSPFTLVSTFRNYYSLV
LEGSVDRESMSVYELVVTARDGGSPALWTSASVMVGIADVNDNAPAFEQTSYTLFVKENN
PPGSHIFTVSASDPDAEENALVSYSLVERQVGERPLSSYVSVHLESGKVYALQPLDHEEI
ELLQFQVSARDSGVPSLSSNVSLQVFVLDENDNPPVVLPPHSGVSPVTELVSQSVAVGHV
VAKIRAVDADSGYNAWLSYELLPEVSVGHRPFRVGLYTGEISTTRTLDESDGPRQTLLVL
VKDHGEPTLKATATVTMSLAAIGQTFQGSSVTSRDFEKSGVGQKVLMNVNVYLIIAICSV
SSLLVLSLLLYVAIRCSSPSQSFCGPGKSTPVCSNTVRSWSYSHQQRQKICSGEGPAKND
LMAFSPNLPPCPGLQGGEQAENIQNLGKPKQPNPDWRYSASLRAGMHSSVHLEEAGILRA
GPGGPDQQWPTVSSATPEPEAGEVSPPVGAGVNSNSWTFKYGPGNPKQPGPEPKKQTQVS
FLLRRKGEASQPHP
Download sequence
Identical sequences K7E2P0
ENSMODP00000040041 ENSMODP00000040041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]