SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000040083 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000040083
Domain Number - Region: 79-173
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000314
Family Myosin rod fragments 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000040083   Gene: ENSMODG00000028049   Transcript: ENSMODT00000043185
Sequence length 193
Comment pep:novel chromosome:BROADO5:8:13430647:13432353:-1 gene:ENSMODG00000028049 transcript:ENSMODT00000043185 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XXXXXXRGPGAGREGWGRPCIHATSCPPTQALPDSSTGQEALENPAALPRELSDSFLPRT
LSLRNSISKILSEAGSEPLEEEWKSISEIASTCNSILEALSQEGQQVPESGDPREALKAE
PEPGPGSLSEKVSHLEMMLKKLQEDLQKEKADKAALQEEVRSLRHNNRRLQAESQSAAAR
LLRASQQLGAPGP
Download sequence
Identical sequences K7E2T2
ENSMODP00000040083 ENSMODP00000040083

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]