SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000040149 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000040149
Domain Number 1 Region: 24-271,340-387
Classification Level Classification E-value
Superfamily (Trans)glycosidases 7.8e-107
Family Type II chitinase 0.0000000423
Further Details:      
 
Domain Number 2 Region: 267-335
Classification Level Classification E-value
Superfamily Chitinase insertion domain 6.81e-24
Family Chitinase insertion domain 0.0000715
Further Details:      
 
Domain Number 3 Region: 422-468
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000366
Family Tachycitin 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000040149   Gene: ENSMODG00000028904   Transcript: ENSMODT00000043251
Sequence length 469
Comment pep:novel chromosome:BROADO5:2:481141663:481154833:1 gene:ENSMODG00000028904 transcript:ENSMODT00000043251 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKLLILTGLALLLQLQLGSAVNIVCYFTNWSQYRPGIARYMPENVDPCLCTHIIYAFAG
MANNQIKTIEWNDEALYAGINNLKTYNTELKTLLSVGGWNFGTQGFSDMVATAANRQTFI
QSAIQFLRKYNFDGLDIDWEYPGNRGSPADTQQLFTVLLKEMYEAFEQEATQSNKPRLLI
SAAVSAGKSTIETAYQIPEMSKYMDLINVMTYDLRGSWEGFTGEDSPLFAGPNDKGDYIY
FNVDYAMNYWKNQGAPAEKLMVGFGAYARTFTLTNPSNHGLDAPTSGPGAAGPYTQEAGT
LAYFEVCGFLKGATEVWNAPQEVPYAYKGNQWIGYDNPKSFTIKADWLLKNNFGGAMVWA
IDLDDFTGTFCGQGKYPLMNAIKSALGVSTPSCRVPTSTLGTSIAPIVTAAPGGGSSGGS
GFCAGKSNGLYANPKSKNAFYNCVNGVTYEEACQAGLVFDTSCSCCNWS
Download sequence
Identical sequences K7E2Z8
ENSMODP00000040149 XP_001381990.1.35504 ENSMODP00000040149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]