SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000040167 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000040167
Domain Number 1 Region: 224-459
Classification Level Classification E-value
Superfamily Caspase-like 1.23e-65
Family Caspase catalytic domain 0.00000569
Further Details:      
 
Domain Number 2 Region: 94-187,217-247
Classification Level Classification E-value
Superfamily DEATH domain 1.29e-23
Family DEATH effector domain, DED 0.0058
Further Details:      
 
Domain Number 3 Region: 3-111
Classification Level Classification E-value
Superfamily DEATH domain 1.88e-22
Family DEATH effector domain, DED 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000040167   Gene: ENSMODG00000029656   Transcript: ENSMODT00000043269
Sequence length 471
Comment pep:known chromosome:BROADO5:7:171568675:171621705:1 gene:ENSMODG00000029656 transcript:ENSMODT00000043269 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEILLQIKDKLTRSDLESLKFLSSDIIPLQKQENITRSLAFFQALQKRELLDNNSILEE
LLFLIGRKDILTKQLNVNIEELKRKLQHSDSLKISPYRKLLFKIAENMTSDYLDSAKFLL
RRDLPQSKLEGIKTPLKLFIEMEKHGLIEKTNLKALKDILQSLNAECLLKHIKEYEKKTK
DLAGSAVTAQLESHLGHLSLLSGNAGQAAAPLNIPEESEMNTLPQSMPPYKMEHVPHGYV
VIIDNIHFSNPVDVRIGTEKDVAALRKVFGRLQFKEKYHSNLDASQLHEVMKDYSKRDYT
DQDAFICCILSHGKKGVVLGTDWKPVAIKKLLSYFTANECKTLKDKPKLFFIQACQNGKS
DSLPEVDVEFDLEADAICSNTTHEWSDIFIGMATVEDSLAQRSGSIGSPYIQNLCKELEA
HCPQKKELLEIMTSVNSKVSNIIQMPEFRSTLRAPFIFQVPEESQKAPIGH
Download sequence
Identical sequences K7E316
ENSMODP00000040167 XP_007501565.1.35504 ENSMODP00000040167

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]