SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000040181 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000040181
Domain Number 1 Region: 35-351
Classification Level Classification E-value
Superfamily Nucleoside hydrolase 3.27e-84
Family Nucleoside hydrolase 0.00000665
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000040181   Gene: ENSMODG00000001080   Transcript: ENSMODT00000043283
Sequence length 352
Comment pep:novel chromosome:BROADO5:7:59619475:59723791:1 gene:ENSMODG00000001080 transcript:ENSMODT00000043283 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFLRLMRPVLCSWKAGGSRWRLACLRGSKTVPAMEKKLLLVDVDAGVDDAAALMIALAAP
NVEILGITCCFGNTEVENVCKNVLRVLKKCHHLQIPVYQGASSPLLNTMKNDYFYGTDGL
GDVPDAEAPGLDRVQHEHAVAAMIRIISERPNQVTLVATGPLTNLALAVKMDPKFPKKIK
NMSIMGGNMYSRGNIDICAEFNFAADPEAAYIVLNEYTCPTFITTWEFACLHAVPWEFYE
KCTSQDSEKARFLKEIYAVTTEIQKRPIPKLRALYRKPGFVSCDSIAMAIAVDQNVVTES
IFCPVSVELTGSHTRGMLVLDMDDALKKENKVSIAKELDMEKFKSLLLGALK
Download sequence
Identical sequences F7GHY7
ENSMODP00000040181 ENSMODP00000001284 XP_001367847.3.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]