SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000040233 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000040233
Domain Number 1 Region: 31-64
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000288
Family Intermediate filament protein, coiled coil region 0.0022
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000040233
Domain Number - Region: 87-176
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0034
Family Myosin rod fragments 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000040233   Gene: ENSMODG00000028967   Transcript: ENSMODT00000043336
Sequence length 238
Comment pep:novel chromosome:BROADO5:3:56821568:56853376:1 gene:ENSMODG00000028967 transcript:ENSMODT00000043336 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METTTPKVQKTGGQASKPATPLSPTRLSRLREKEELRELNDRLVAYINKVRSLESENSLL
QLQVTEREELRDRELTGLKALYETELADARRALDDTASEKAHLQIELGKLKTEYNQLQLN
YIKNTSELNAAHIKLREHEASLNFQEAALATALRDKKSLEGNVEELREQIVQLEASLVAA
KKQLADEALFKVDLENCCQSLTEELEFHKNLYEEVKKITLNFKVKNKNALYLHWWFTF
Download sequence
Identical sequences K7E382
ENSMODP00000040233 XP_007486676.1.35504 XP_016286860.1.35504 ENSMODP00000040233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]