SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000040235 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000040235
Domain Number - Region: 242-276
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0968
Family Myosin rod fragments 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000040235   Gene: ENSMODG00000029220   Transcript: ENSMODT00000043338
Sequence length 308
Comment pep:novel chromosome:BROADO5:6:1167325:1446948:-1 gene:ENSMODG00000029220 transcript:ENSMODT00000043338 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLCHSRKSGSVTPQSDKVMSDTTDKRSIMSNNEGSVMDMPQRSRMTTEALESGEEAPTW
TCLQDLKMCLQEAEDKVKTLSEQLAVSEGTKTKLLEQVSWLEEQLETADIKEVRGEPYEE
IMHAKNQRIEKLQAEVKASQEQLAAHKLKHKRKMKKLQTDLATAKQEAAITVLELNEKIK
TLYEGKPSPRGCLRISFRLLKCKISTIRTCILATRIPEENSLEESCGGLPPVEEGDRRMS
LIMELSTQVSLQTEKINQLEEVLEEKERKIQQLEAERETPMFQMGSPPECLPEAPSASND
RTSAVDID
Download sequence
Identical sequences K7E384
ENSMODP00000040235 ENSMODP00000040235 XP_007497872.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]