SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000040270 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000040270
Domain Number 1 Region: 66-273,350-387
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.79e-46
Family Type II chitinase 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000040270   Gene: ENSMODG00000000421   Transcript: ENSMODT00000043374
Sequence length 396
Comment pep:novel chromosome:BROADO5:2:44115265:44215183:1 gene:ENSMODG00000000421 transcript:ENSMODT00000043374 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSWDDGKLPRPLRCLALALASALLLLSQPHAGLCSAPAPTVRVEVNATAEPCPCAEPALC
SPVRGRRDFEVFVFDIGGKSWKSYDWSQITTVAAFGKYDPELVCFAHSKGARVVLKGDIP
LKNILEPAFREAWIAKQLQLAQKQYMDGINIDIEQEVEEGSPEYDALTALVKETTEAFHR
EIEGSQVTFDVAWSPNCIDKRCYNYKGIADACDFLFVMSYDEQSQMWTECVAAANAPYNQ
TLTGYESYLKMSIDPGKLVMGVPWYGYDYPCLTLSEDHVCALPKVPFRGAPCSDAAGRQV
SYKAIMEQVNRSISEVLWDTQQQAPYYNYQDAAGQFHQVWYDNPKSISLKAAFVRDRGLR
GIGMWNGNCLDYSGDAVAKQQTEDMWRALEPSLLRT
Download sequence
Identical sequences F6VAP2
ENSMODP00000000503 ENSMODP00000040270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]