SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000040314 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000040314
Domain Number 1 Region: 15-43
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000182
Family TNF receptor-like 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000040314   Gene: ENSMODG00000028608   Transcript: ENSMODT00000043418
Sequence length 127
Comment pep:novel chromosome:BROADO5:4:381900623:381905083:-1 gene:ENSMODG00000028608 transcript:ENSMODT00000043418 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTESREFCFVLFLWLSGTPDSDVECAACAPGTFSDTISSTDTCKPHRRCLSVATPGNATS
DAICNDMDFAPTKAEPPFSKHQPEFMNPKETTWTSEPNVTLATSPQPQPQPTVRQVSSDS
PVLPLGK
Download sequence
Identical sequences K7E3G2
ENSMODP00000040314 ENSMODP00000040314 XP_007491822.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]