SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000040318 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000040318
Domain Number 1 Region: 89-127
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000752
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000040318   Gene: ENSMODG00000027817   Transcript: ENSMODT00000043422
Sequence length 172
Comment pep:novel chromosome:BROADO5:2:314687460:314755711:-1 gene:ENSMODG00000027817 transcript:ENSMODT00000043422 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEELPSSTVWGCEGIKCEVDIYYCLLYMASCMARFLCVEKPHETTNKCWLSCPESIECAK
VECYYAEEHNNSYHSLCAAGWTCKTFLLNINGCEENGYQHGAICEDGINEYRCGCLQGGD
GFFCGIKTNMCVSETCKNGSTYMCLNDHVFWQCDTGFIGKCFLRYLTFLFLN
Download sequence
Identical sequences K7E3G6
ENSMODP00000040318 ENSMODP00000040318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]