SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000040366 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000040366
Domain Number - Region: 10-52
Classification Level Classification E-value
Superfamily Prefoldin 0.00214
Family Prefoldin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000040366   Gene: ENSMODG00000029021   Transcript: ENSMODT00000043472
Sequence length 199
Comment pep:novel chromosome:BROADO5:4:93289317:93304520:-1 gene:ENSMODG00000029021 transcript:ENSMODT00000043472 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKMTSEASSLQPLKEAMKRVENKLQTLETQFEELDSAMENLTKKFEFHRKTLASQAVQDE
MWTAVLEIKFTSLELNIFYSYIIETLHYLHSQVLEKLPDLARGLPTLATVLKRKNNNKRI
RVVWETVLEALELQEEDVKAFCTFFIAHSSKAEYYSANLRQLYIPDATPIITNIVKNQVL
KNSLLHAVQVIEKKKTMNA
Download sequence
Identical sequences K7E3L4
XP_001374093.2.35504 ENSMODP00000040366 ENSMODP00000040366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]