SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000040382 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000040382
Domain Number 1 Region: 137-273
Classification Level Classification E-value
Superfamily TIMP-like 2.35e-28
Family Netrin-like domain (NTR/C345C module) 0.042
Further Details:      
 
Domain Number 2 Region: 9-63
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000502
Family Laminin-type module 0.027
Further Details:      
 
Domain Number 3 Region: 72-113
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000148
Family Laminin-type module 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000040382   Gene: ENSMODG00000028233   Transcript: ENSMODT00000043488
Sequence length 273
Comment pep:novel chromosome:BROADO5:Un:71079035:71080782:1 gene:ENSMODG00000028233 transcript:ENSMODT00000043488 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LAPFHPPACSCNLHARRCRFHADVFRLSGGRSGGVCERCRHHTAGRHCHYCERGYWRDPR
QPLSSRKACRACQCHPIGATGTQCNQTSGQCPCKAGVTGPSCDRCAPGYQQSRSIRRPCQ
RIPEIRNTEATPPSVYTPDPTCQSLCNASEAQVHMSSQQYCHQAYVLRAQVQSAEPSGPT
WWRLRIRVLAVYKQRAEPLSTGVQDAWVPRADLVCGCLTLRPGAVYLLLGGPPGGPDPTR
LVLDHRGRALPWRPQWAQTLRRRQREERAGSCP
Download sequence
Identical sequences K7E3N0
ENSMODP00000040382 ENSMODP00000040382 XP_007505553.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]