SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000040512 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000040512
Domain Number 1 Region: 121-397
Classification Level Classification E-value
Superfamily Caspase-like 1.79e-64
Family Caspase catalytic domain 0.0000011
Further Details:      
 
Domain Number 2 Region: 19-76
Classification Level Classification E-value
Superfamily DEATH domain 0.00000377
Family Caspase recruitment domain, CARD 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000040512   Gene: ENSMODG00000029629   Transcript: ENSMODT00000043618
Sequence length 398
Comment pep:novel chromosome:BROADO5:4:250266015:250294891:1 gene:ENSMODG00000029629 transcript:ENSMODT00000043618 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEGKKKNDPWDVLKNSAMKVLKDFCDDLIEQDVFNQNEIKNMGKQLSTVKDKSEDLVKI
VTHKGSQIGDIFVKRVLMAAKQLHSGTQAADENLESIEYAGMSQAVTSLLSAPLAIQAAE
SRLNKVKLSPTEFYQELSEAKREKMYLVMEKGSRTRLALIICNTKFDHLQELNKAQFDIE
RMKDLLQILGYRVEVKKELSSVDMESVLKQFALRQEHESSDSTFLIFMSYGTTTGICGIK
HKQLEPDILANDTIFKIFNNSNCSRLRNKPKIIIIQECQEGIISEQGAMAASADSYNQSS
SSDTEGFWKDAARKEHVEKDFICFHSITPNDISLEDNQEGSLFVTLLTDCFQQYSWCCHV
EDLFKKVQKSFATSPVPVPMPTIERQSMTRYFYLFPGI
Download sequence
Identical sequences K7E410
XP_007494970.1.35504 ENSMODP00000040512 ENSMODP00000040512

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]