SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000040756 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000040756
Domain Number 1 Region: 15-149
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000046
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 2 Region: 169-215
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000033
Family TNF receptor-like 0.017
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000040756
Domain Number - Region: 225-267
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00339
Family TNF receptor-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000040756   Gene: ENSMODG00000029092   Transcript: ENSMODT00000043863
Sequence length 267
Comment pep:novel chromosome:BROADO5:4:287712862:287724816:1 gene:ENSMODG00000029092 transcript:ENSMODT00000043863 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYCPVPGLTKPSGLCKGGFHCIRGAFIPNPIDGITGNLCPSGYTCPQGSPEPAPCPPGSF
LPSPGSLSTKDCQPCPAGWFCSQQGLSFPEAPCVAGWFCPISSISGQNPGHLCPLGHYCP
LGSLEPHLCPSGQYQDETGQSQCKMCPAGKFCPSRVQSSESRDPFWPMDCPTGYYCPPGT
QSSTQYPCPTGTFSKRPGASSPEECQPCPAGQFCNLDIGVHGPERCPQGHFCPPGTHSPT
EHPCPQGTFGPRPGSTSELGCEPCPAG
Download sequence
Identical sequences K7E4Q4
ENSMODP00000040756 ENSMODP00000040756

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]