SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000040980 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000040980
Domain Number - Region: 99-155
Classification Level Classification E-value
Superfamily (Trans)glycosidases 0.00653
Family beta-glycanases 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000040980   Gene: ENSMODG00000028699   Transcript: ENSMODT00000044090
Sequence length 212
Comment pep:novel chromosome:BROADO5:1:71717217:71827208:1 gene:ENSMODG00000028699 transcript:ENSMODT00000044090 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSPILESREYLILRVDEDGREGRKEGRKQASKQQAYHGDILSTGDRRTFPVGKSQGVKEK
TLILLDVSTKSPVRTVNENFLSLQLDPSIIHDGWLDFLSSKRLVTLARGLSPAFLRFGGK
RTDFLQFQNLRNPAKSRGGPGPDYYLKNYEDDIVRSDVALDKQKGCKIAQHPDVMLELQR
EKAAQMHLVLLKEQFSNTYSNLILTGKATKVS
Download sequence
Identical sequences K7E5C8
ENSMODP00000040980 ENSMODP00000040980

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]