SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000040999 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000040999
Domain Number 1 Region: 7-64
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000442
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000040999   Gene: ENSMODG00000028048   Transcript: ENSMODT00000044109
Sequence length 93
Comment pep:novel chromosome:BROADO5:7:233765371:233779466:-1 gene:ENSMODG00000028048 transcript:ENSMODT00000044109 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEIVNSCEQNNGGCSHHCEHSTGGPRCSCNHGHRLDMDGKTCKDLDECESGQACCSQLCI
NYLGGYECDCKTGFQLSPDGCGCDGKYLGFVFK
Download sequence
Identical sequences K7E5E7
ENSMODP00000040999 ENSMODP00000040999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]