SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000041034 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000041034
Domain Number 1 Region: 1-49
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000000000000162
Family N-terminal domain of xrcc1 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000041034   Gene: ENSMODG00000028459   Transcript: ENSMODT00000044144
Sequence length 88
Comment pep:novel chromosome:BROADO5:Un:73006238:73009232:1 gene:ENSMODG00000028459 transcript:ENSMODT00000044144 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEIRLRHVVSCSSQDPTHSADNLLKADTYRKWRSAKAGEKQISVILQVTPLPRTPLPGL
GRCGLSDPGPLLSSPQLERRSRSQHRCR
Download sequence
Identical sequences K7E5I2
ENSMODP00000041034 ENSMODP00000041034

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]