SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000041039 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000041039
Domain Number - Region: 18-129
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000863
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number - Region: 125-148
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0279
Family TNF receptor-like 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000041039   Gene: ENSMODG00000028425   Transcript: ENSMODT00000044149
Sequence length 240
Comment pep:novel chromosome:BROADO5:4:389320312:389337156:-1 gene:ENSMODG00000028425 transcript:ENSMODT00000044149 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVVGTSWIMGPWWGIILLCSRGQGLDPSPSMRCGSGQILHPASSVWRCCSQCNSSTKACQ
PNQLKDCTCAIPGEYCTKSDCKYCKKHPCSPGQQIHIKGEFLFTFLCKDCEDGTYSDGID
GNCVPWTDCSRSGFLTVRPGNRTHNVLCGLAPLPGPGFLDSYNIPVAILTGLTVVIILIV
LFHLVLHIWPVKREPSPKEREPILPLGPGPPDDIGNCPFPEEEWGEKTAEDKVQMGHPWV
Download sequence
Identical sequences K7E5I7
ENSMODP00000041039 ENSMODP00000041039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]