SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000041057 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000041057
Domain Number 1 Region: 107-273
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.73e-51
Family SPRY domain 0.0000833
Further Details:      
 
Domain Number 2 Region: 13-88
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000429
Family RING finger domain, C3HC4 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000041057   Gene: ENSMODG00000027548   Transcript: ENSMODT00000044167
Sequence length 314
Comment pep:novel chromosome:BROADO5:6:147459190:147466469:-1 gene:ENSMODG00000027548 transcript:ENSMODT00000044167 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQEPAWEAPRVMASYLISNLYEGLKCPICLDFFTCTTSIECGHTFCTGCLYELIMKTSKS
KFSCPKCLKKCRKTFRPNQPLEAVAQSFRLLRLHMGRNLQLRHVIKRKFQEEICLDPETA
HPGIILSEDMKTMKGSESWKKLHCAMEMPTQCGTVLATQSFTSGRHYWEVTVGKSSAWDV
GLCKTSISKTGQVSPCPSTGFWLLSRRQNNYLICTRPRTVISLKEKFNKVGIFLDYEAEE
IVFYDVDNRCQIYTFTGSFLEPLWPIFSIDLYSKDENLLTIDPISDEAEEAPEHDHDTCL
EISSTGEPQSVTPM
Download sequence
Identical sequences K7E5K5
ENSMODP00000041057 ENSMODP00000041057 XP_007499179.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]