SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000041092 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000041092
Domain Number 1 Region: 148-422
Classification Level Classification E-value
Superfamily Caspase-like 2.09e-73
Family Caspase catalytic domain 0.000000221
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000041092
Domain Number - Region: 9-61
Classification Level Classification E-value
Superfamily DEATH domain 0.000432
Family Caspase recruitment domain, CARD 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000041092   Gene: ENSMODG00000028335   Transcript: ENSMODT00000044202
Sequence length 423
Comment pep:novel chromosome:BROADO5:4:250234898:250250391:1 gene:ENSMODG00000028335 transcript:ENSMODT00000044202 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEQKQSYYPVKIVKGLISTFVDGVIDDLIEKDVLSPNELKHLEKEFSTILNQSEGLVDA
LDHIFRGSQIIMKKLLLPYLPGNSGSQREDNELAVFMKSKEMHPILSALETICNSSGSVQ
SYRQRLGNSIFQFFKKIDSNAIQAAVPPNQVKLCRPDFYQGLKEAKEGDIYPIMEKGTRT
RLALIICNILFDYLDERQGAYLDIWGMWKLLENLGYTVIIKTNLTAQKMESVLKEFADRP
EHLSSDSTFLVFMSHGLLNGICGIEHTKQKPDLLATDVIFQIFNDSNCPSLKGKPKVIII
QACRGEKLGITYVMDTPESSAGTPDQPMEDHSGNNPLEQKLLEKDFISFCSTTPHNVSWR
VDILGSVFINELIYCFQQYAWCCHLEEIFRKVQKSFEIPKILVQMPTIERQSISRYFYLF
PGI
Download sequence
Identical sequences K7E5P0
ENSMODP00000041092 XP_007494969.1.35504 ENSMODP00000041092

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]