SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000041262 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000041262
Domain Number 1 Region: 1-108
Classification Level Classification E-value
Superfamily Cytochrome P450 5.37e-37
Family Cytochrome P450 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000041262   Gene: ENSMODG00000028690   Transcript: ENSMODT00000044371
Sequence length 117
Comment pep:novel chromosome:BROADO5:Un:78804490:78808160:-1 gene:ENSMODG00000028690 transcript:ENSMODT00000044371 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFYPEIQGKIQAEIVKMLCHSRHPPMADRENMPYTNAAVHEVQRMGNIIPLNPPRVAAV
DTTVAGYHMPKGTRVVTNMTSLHRDPKEWATPETFNPEHFLENGEFKKRVLSAFLSR
Download sequence
Identical sequences K7E660
ENSMODP00000041262 ENSMODP00000041262

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]