SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000041270 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000041270
Domain Number - Region: 122-270
Classification Level Classification E-value
Superfamily Type II DNA topoisomerase 0.0353
Family Type II DNA topoisomerase 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000041270   Gene: ENSMODG00000006130   Transcript: ENSMODT00000044379
Sequence length 702
Comment pep:novel chromosome:BROADO5:1:454284820:454318673:1 gene:ENSMODG00000006130 transcript:ENSMODT00000044379 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSEGRCWETLQALRSSDKGRLSYHRDWLLRGEEILEECMSIPELSTYSGWVVDHILPHS
HQNQHPSENSTLSSAPDQVLSIPKSPARHAKVSSPVSLAAPTGTQCQDEYHQAKFVVLRP
SRGMEVEGCIRMYEEVHRMKGTKGLRQWQEEHERKVRVLSEMASEQLKRFDERKSLKQHK
EYQDLREVIEKSFKEAQGQQEKLKEEHRHRAKILNLKLREAEQQRLRQIEQERLRKEEGQ
DRLRRLYALQEEVLQLNQQLDPNYQHKDLLRVDLSGYGSRGNQLCGLISDIIRTTSERGF
PAPEDEAMAERALQEMRQVLTGLQQEIAKAIEEKRRRDEEESKDKQGELEQQPKAEKETP
DPVQCPGGKQREGLHVKAGDSTMQWYQQLQDAANQCILAFDGLTNSKDHQSKKIKMDLQK
AATIPVSQISTIAGSQLKEIFDKINNLLLGKAVHCGGRAVSVTNHQQGLDFVHYKLAEKF
VKQGEEEVASHHEAAFPIAVVASGIWELHPRVGDLILAHLHKKCPYSVPFYPAFKEGMAL
EEYQKLLGYQVKDSKVEQQDNFLKRMSGMIRLYAAIIQLRWPYGNRQGAHPHGLNHGWRW
LAQILNMEPLSDVTATLLFDFLEVHSTIPSGWSQWAKMPFNSLLNRKMCLSATEWKYHVL
WRCQANSTRNQGLQVLFKASKYVKGNPELVVFSLCAKLFLCK
Download sequence
Identical sequences K7E668
ENSMODP00000041270 ENSMODP00000041270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]