SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000041337 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000041337
Domain Number 1 Region: 7-92
Classification Level Classification E-value
Superfamily DEATH domain 6.59e-21
Family Caspase recruitment domain, CARD 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000041337   Gene: ENSMODG00000028096   Transcript: ENSMODT00000044445
Sequence length 107
Comment pep:novel chromosome:BROADO5:4:250308778:250326549:1 gene:ENSMODG00000028096 transcript:ENSMODT00000044445 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEAMAVQQLKEKKNMFVESVNKDIINGLLDDLLESGMITQEKMEELRDENVTMMDKALA
LIEYVIWKGPEACQLLIKSIWHRDPHLARKMNLPYSSEYGDSAEKFV
Download sequence
Identical sequences K7E6D5
ENSMODP00000041337 XP_007494972.1.35504 ENSMODP00000041337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]