SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000000834 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000000834
Domain Number 1 Region: 555-824
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.06e-87
Family Eukaryotic proteases 0.0000714
Further Details:      
 
Domain Number 2 Region: 334-450
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000000127
Family Spermadhesin, CUB domain 0.0037
Further Details:      
 
Domain Number 3 Region: 84-170
Classification Level Classification E-value
Superfamily SEA domain 0.000000000011
Family SEA domain 0.009
Further Details:      
 
Domain Number 4 Region: 217-334
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000051
Family Spermadhesin, CUB domain 0.0061
Further Details:      
 
Domain Number 5 Region: 491-524
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000011
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number 6 Region: 458-491
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000301
Family LDL receptor-like module 0.0019
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000000834
Domain Number - Region: 529-567
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000446
Family LDL receptor-like module 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000000834   Gene: ENSMODG00000000693   Transcript: ENSMODT00000000852
Sequence length 825
Comment pep:novel chromosome:BROADO5:8:91804919:91856413:-1 gene:ENSMODG00000000693 transcript:ENSMODT00000000852 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDEEHRGNGQVIPGQLYGVDLEEPENRQRGQGPVEKTKATDDPKRRRDYLRLTPLWLAL
VMLAAGGILLWYFLAGYKSEVTVSQLYSGSIRVLNRHFNLDLSRRDSSAFRSETAKAQKM
LRELIFTTRLAPYYNSSTVYAFGEGPLTCFFWFILQIPESRRQTLTPEAVKEVLVERLLS
NANETSGTLDQEEYEVDPGGLVLLETSVKDIVLLNSTLGCYRYSYISEGQILRLKGPDHL
ASSCLWHLQGPENYMIKIRLEWTLAECRDRLAMYDVAGPLESRLITSLYGCSRQEPVVEV
LSSGHVMSVVWKKGLYSYYDPFTLSVQAVAFQDCQVNLTLEGKLELQGNISTPYYPSYYS
PSTHCTWHLMVPSLDYGVALWFEAYALRRQKYDLPCTQGQWTIQNRRLCGLRTLQAYAER
IPVVTSAGITINFTSQISLTGPGVQAHYSLYNQSDPCPGEFLCSVNGLCVPACDGIKDCP
NGLDERNCVCPSTFQCEEDSTCIQLPKVCDQHWDCINGSDERQCHGGVSCGAFKYQCADG
SCLKKPNPQCDDNPDCSDLSDEQHCDCGLPAPATRIVGGATSVEGEWPWQASLQVKGRHI
CGGTLVSDQWIVTAAHCFQEDSMASPGVWTISLGRIHHGARWPGGVSFKVSRLLLHPYYE
EDSHDYDVALLQLDHPVVRSTLIRPICLPAPSHFFQPGIHCWITGWGALQEGGSRVPPLN
LAPPHLAGPSSNTLQKVDVELIQQDLCSEAYRYQITPRMLCAGYRRGKKDACQGDSGGPL
VCKESSGRWFLAGLVSWGLGCGRPNYFGVYTRITRVMGWIQQVLS
Download sequence
Identical sequences F6WLV0
ENSMODP00000000834 ENSMODP00000000834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]