SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002280 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002280
Domain Number 1 Region: 62-247,420-508
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.83e-48
Family Bacterial dinuclear zinc exopeptidases 0.0017
Further Details:      
 
Domain Number 2 Region: 263-310,356-408
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 0.000000000121
Family Bacterial exopeptidase dimerisation domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002280   Gene: ENSMODG00000001870   Transcript: ENSMODT00000002327
Sequence length 524
Comment pep:novel chromosome:BROADO5:2:111960883:112012069:-1 gene:ENSMODG00000001870 transcript:ENSMODT00000002327 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPRDVARAAGMSAGVRALAKGVVGTVLALGAVLLLRTATFPGPDELPDWGQAGTSRIPA
QFSETERTAMKEALKEAIRMPTVAFSSENINTTALAEFGQFLPKVFPSMFSTSFIHHEVV
EEYSHLFTIRGSNPKLEPYMLLAHIDVVPASEDGWEVPPFSGLERDGFIYGRGTLDNKNS
VMAILQAMELLLRRNYVPQRSFYISLGHDEEVSGKHGAQKIAALLESRGIRLSFIIDEGG
YIFDSFFSGIEKPFAVISVSEKGGMNLMLQVDSAPGHSSAPPKETSIGILAAAVSRLEQT
PMPNMFGDGPEKALLEQLAGQFSFPLNVILTNLWIFGPIMKRILEKTPVSNAMIRTTVAL
TMFNAGIKVNVIPPTAQATVNLRIHPAQTIPEVLEIIQNIVADDRVQYQVLSVFNPLPMS
PYDSDAFGYQLLRRTIKDVFPEVTAVVPATCIGNTDVRHFANISTGLYRFNPVILQPQGF
NSFHGLNEKISIQAYETQVMFLFELIQNADVEKVPVPHSATHDL
Download sequence
Identical sequences F6S6G5
ENSMODP00000002280 XP_001372212.1.35504 ENSMODP00000002280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]