SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002418 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002418
Domain Number 1 Region: 802-911
Classification Level Classification E-value
Superfamily SEA domain 6.54e-19
Family SEA domain 0.01
Further Details:      
 
Domain Number 2 Region: 239-332
Classification Level Classification E-value
Superfamily SEA domain 0.000000301
Family SEA domain 0.0094
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000002418
Domain Number - Region: 961-1003
Classification Level Classification E-value
Superfamily EGF/Laminin 0.03
Family EGF-type module 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002418   Gene: ENSMODG00000001983   Transcript: ENSMODT00000002469
Sequence length 1138
Comment pep:novel chromosome:BROADO5:4:62675204:62790595:1 gene:ENSMODG00000001983 transcript:ENSMODT00000002469 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KKMFSFSWKTSLSILIFVLIEGGHQTAQTYLPSGKIQESRVSVSPYRMSLQSSEEKPLDY
RKNKWQRLFRQKRTTLFPNGVKICPDETVAQTVANHLKYFKVRMCQEAVWEVFKTFWDRL
PRREEYGHWMTLCEEGTISIFEMGTNFSQSEEHQSLITKLVLLGREGVSITESSTPVTSY
DSSTLRDTAANASSPRVASFQDFSDSDSERPDDSINNEIETLTETPPKLATEQVAEFIMH
LSGKEYIEELQDPSSRHHQELTQQFISEVEKSFDGLPGYKDIHVLEFRFFFFLLNLSGID
VRYAVTFDSEAISNITWEMINLHSNKVENHGLVERENKPTAVYTINNFRDYIAESLNRNF
VLGNSSLKPDLDSLQFINDVFFPQTEDPLWNVGSPSLLVTQPLILDKTLQAEWPSADESA
ARSSSPLDFTKPGLIFGTLPSTGSELWPKSESPPPDLVSPSKLPLPWKVGSTSPPEVLEG
SSLTLHSVTPAVPQTGLPLAPEKRTSGPVLLGEGPTNVEEPGDFFPFDLLTSNPPSHLVP
MPSVDDSELPLSSLSTLASPSMLDSIDIEITTPFGLDPLASPNKDQLEANIFQPETYPES
GPIFESQSGSGSGHELLPGPWSKPSLHHGTGPPSESWFENEESTVAFVSTNDRLEKIEFS
QEEKPKEILESSSTELSDIDVSTGKSSMELLWTGLSKFNVTQSTTSFPRRPTKDTLASTA
KNIDTLLSRVSISESTKLSPTLSSTNLEDDMIMNVQDISLELDPVGTGYYQPELNQEESS
KMPTNMPSTERAYPNYSQTKGPLVVFFSLRVMNMLFSEDLFNKNSPEYKALEQRFLELLV
PYLQSNLTGFQNLEILNFRNGSIVVNSRVKFAKPVPHDVNNAVYTILEDFCNTAYQTMNL
AIDKYSLDVESGDQADPCKFQACNEFSECVVNRWSGEAECICYPGYQSLQELPCQSVCEL
QPHFCLNDGKCDIIPGHGAICRCRVGENWWYRGEHCEEYMSESQVIGIAVASVIGFLLVV
MAVLFFLAKTLVDQYVKRGRKGSLSRRGDSPSSLENAVRYNPVFESDVTGYDQYGRSYPQ
LTSYSPALGEEPADLSREEIRQLYEHSELSSEEIQERIRMFELYAKDQQFAEFVRQHQ
Download sequence
Identical sequences F7FXK4
ENSMODP00000002418 ENSMODP00000037268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]