SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002506 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002506
Domain Number 1 Region: 117-172
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.53e-19
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 2 Region: 2-57
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.96e-17
Family KRAB domain (Kruppel-associated box) 0.0017
Further Details:      
 
Domain Number 3 Region: 161-214
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000795
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000002506
Domain Number - Region: 93-127
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000953
Family Classic zinc finger, C2H2 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002506   Gene: ENSMODG00000002056   Transcript: ENSMODT00000002558
Sequence length 216
Comment pep:novel chromosome:BROADO5:1:636634784:636635591:1 gene:ENSMODG00000002056 transcript:ENSMODT00000002558 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLTFKDVAMDFTQEEEHLLTPPQKELYREVMLQNTQNLLSVRLPAPLQDAVSYLEQREAQ
WMLEQEGLRSCCPEGEITPEMKATPTENSVLNLKSLTEHQRMTSVEMSNECNCCGKTYIH
RSSLTGHQRMHTEEKPYECKQCGKAFSQRFHLIGHEGMHSGEKHYEFKQCGKTIDQSSKN
PHWKMHTGEKTCECKQCEKTFKWSSSLALHHRKHRL
Download sequence
Identical sequences F6V087
ENSMODP00000002506 ENSMODP00000002506 13616.ENSMODP00000002506

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]