SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002721 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002721
Domain Number 1 Region: 338-593
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.07e-92
Family Hsp90 middle domain 0.000000235
Further Details:      
 
Domain Number 2 Region: 74-296,331-370
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 7.2e-70
Family Heat shock protein 90, HSP90, N-terminal domain 0.00000000325
Further Details:      
 
Domain Number 3 Region: 616-742
Classification Level Classification E-value
Superfamily HSP90 C-terminal domain 1.28e-31
Family HSP90 C-terminal domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002721   Gene: ENSMODG00000002234   Transcript: ENSMODT00000002776
Sequence length 804
Comment pep:novel chromosome:BROADO5:8:83681692:83697017:1 gene:ENSMODG00000002234 transcript:ENSMODT00000002776 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKALWLLGLCCVLLLACGSVKADDPVDVEATVEEDLGKSREGSRTDDEVVQREEEAIQLD
GLNASQIKEIREKSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLIS
LTDENALSGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIAKSGTSEFLNKMT
EAQSDGQSTSELIGQFGVGFYSAFLVADRVIVTSKHNNDSQHIWESDSNEFSVIADPRGD
TLGRGTTITLALKEEASDYLELDTIKNLVKKYSQFINFPIYLWSSKTETVEEPIEEEEAA
KEKDEVDDEAAVEDEEEKKPKTKKVEKTVWDWELMNDIKPIWQRPSKEVEEDEYKAFYKS
FSKESDDPMTFIHFTAEGEVTFKSILFVPTSAPRGLFDEYGSKKSDYIKLYVRRVFITDD
FHDMMPKYLNFIKGVVDSDDLPLNVSRETLQQHKLLKVIRKKLVRKTLDMIKKIAEEKYN
KTFWKEFGTNIKLGVIEDHSNRTRLAKLLRFQSSHHENDLTSLDQYVERMKEKQDKIYFM
AGSSRKEAESSPFVERLLKKGYEVIYLTEPVDEYCIQALPEFDGKRFQNVAKEGVKFDES
EKTKESRAVVEKEFEPLLEWMKDKALKDKIEKAVISQRLTESPCALVASQYGWSGNMERI
MKAQAYQTGMDISANYYASQKKTLEINPRHPLIKDMLRRVKEDEDDKTVLDLAVVLFETA
TLRSGYLLPNTKEYGDRIERMLRLSLNIDPDAKVEEEPEEDQEDDTTEEASEDSKPEEEE
EVDDVDAEEEEETKKKSSSEKDEL
Download sequence
Identical sequences F7DFT7
ENSMODP00000002721 ENSMODP00000002721 XP_001365625.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]