SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000003330 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000003330
Domain Number 1 Region: 183-240
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.5e-22
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 2 Region: 439-496
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.91e-21
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 3 Region: 227-287
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.86e-20
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 4 Region: 524-580
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.05e-19
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 145-197
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000729
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 6 Region: 277-310
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000331
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 7 Region: 486-517
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000482
Family Classic zinc finger, C2H2 0.025
Further Details:      
 
Domain Number 8 Region: 359-389
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000699
Family Classic zinc finger, C2H2 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000003330   Gene: ENSMODG00000002740   Transcript: ENSMODT00000003399
Sequence length 621
Comment pep:novel chromosome:BROADO5:8:214134328:214144705:-1 gene:ENSMODG00000002740 transcript:ENSMODT00000003399 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPQIEPGDRPHEAQEQTAPSGGEGPPGAYSGTLVPKPEDVFQSEQGEEQNMAEPGVEPQ
KTEPESSCPEDWMIRKVKVEDEDMGEEEEVVWPQHLPQLLPSGPFLPADLGPLAAVATAC
KLEPGAPPAPLSGLALASWPQVLEKPYGCGECERRFRDQLTLRLHQRLHRGEGPCACPDC
GRSFSQRTHLLAHLRSHRGERPFPCPECGKRFSKKAHLTRHLRTHTGERPYPCEECGKRF
SQKIHLGSHQKTHTGERPFPCAECEKRFRKKTHLIRHQRIHTGERPYQCTECGRSFTHKQ
HLVRHRRVHAAAAAAAAAAAAAAAAAGAAAAGPAPPPPPQPPATDPLCQEASTAPPEPRA
FACADCGKDFGWKKNLASHQRVHRGNRPFGFSERPRGQGERCPPGAAGAAAAAAVAVAAA
AAAAHTAIKAFACTHCGKSFSQRPGLVAHQRTHAGERPFRCPDCGRGFSHGQHLTRHRRV
HTGERPFACTQCGRRFGSRPNLAAHTKVHSGARPFACAQCGRGFSRKSHLGRHQAVHTGS
RPHACTVCSRCFSSKTNLIRHQAVHTGSRPFPCTQCGKSFSRKTHLARHQRTHGEITHLD
PNLASPAWPVPTVPTPTPLFL
Download sequence
Identical sequences F6Z711
XP_007504617.1.35504 XP_016281709.1.35504 ENSMODP00000003330 ENSMODP00000003330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]