SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000006611 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000006611
Domain Number 1 Region: 543-574
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000536
Family C2HC finger 0.018
Further Details:      
 
Domain Number 2 Region: 683-714
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000149
Family C2HC finger 0.015
Further Details:      
 
Domain Number 3 Region: 1114-1145
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000015
Family C2HC finger 0.011
Further Details:      
 
Domain Number 4 Region: 848-878
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000265
Family C2HC finger 0.014
Further Details:      
 
Domain Number 5 Region: 245-276
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000675
Family C2HC finger 0.024
Further Details:      
 
Domain Number 6 Region: 336-385
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000195
Family Classic zinc finger, C2H2 0.035
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000006611
Domain Number - Region: 297-324
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00271
Family Classic zinc finger, C2H2 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000006611   Gene: ENSMODG00000005359   Transcript: ENSMODT00000006748
Sequence length 1151
Comment pep:novel chromosome:BROADO5:3:372495221:373067351:1 gene:ENSMODG00000005359 transcript:ENSMODT00000006748 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRRKQSKPRQIKRPLEDAVDDEEEECLSEGNDIILKGDFPLEESFSTEFGPENLSCEEV
EYFCNKGDEEGIQETTESDGDTKSEKPGQLSTETDEWDGPGELEVVQKDGERKIQSRQQL
PVGTTWGPFAGKMDLNNNTLKTKAPVPMVLTAGPKWLLDVTWQGVEDNKNNCIVYSKGGQ
LWCTTTKAISEGEELIAFVVDFDSRLQAASQMTLTEGMYPARLLDSIQLLPQQAAMASIL
PTAIVNKDIFPCKSCGIWYRSERNLQAHLMYYCSGRQRDGPPMTEENEDAPHQISSACPF
PQCTKSFSNARALEMHLNSHSGVKMEEFLPPGTSLKCTVCNYTADSVINFHQHLFSHLTQ
AAFRCNHCHFGFQTQRELLQHQEVHGSGNKLPRESDIEHSPNGNEDNLQPTTELLNRNEL
PQSQKGMQTKDASSDTELDKCEKKNQLFLPNQRPELQPSTNKQSFSYTKIKSEPSSPRLA
SSPVQPGIGPSFPMGPFLSQFAFPQDITVVPQASEILAKMSELVHRRLRHGSSSYPPVIY
SPLMPKGATCFECNITFNNLDNYLVHKKHYCSSRWQQMAKSPEFPSVAEKMPEAVSPNNG
QSSINLLNSAPHSSDPENQLLQTACINSSTVLDLIGPSGKGHDKDFPVQAKKLSASSSND
DKINGKPADVKNPNISLVEGESDPNKTTCDACNITFSRHETYMVHKQYYCATRHDPPLKR
SASNKVPAMQRTMRTRKRRKMYEMCLPEQEPRPQLVQQRFLEVANLNNPCTSTQEPAEGL
GECYHPRCDIFPGIVSKHLETSLSINKCVPVSKCDTTHPSVSCLEMDVPIDLSKKCLSQS
ERTSTSPKRLLDYHECTVCKISFNKVENYLAHKQNFCPVTAHQRNDLGQLDGKGFPNPES
ERNSPEVSYERSIIKCEKNGNLKQPSPNGNLFSTHLATLQGLKVFSEAAQLIATKEESKH
LFLPQCLYPGAIKKAKGADQLSPYYGIKPSDYISGSLVIHNTDIDQSTNADSESPKGQTP
SNGCAGPKKESLPLLPKNRGMVIVNGGLKQDERPATNPQQENISQNPQHEDGHKSPSWIS
ENPLAANENVSPAMPSAEEQLSSIAKGVNGSTQAPTSGKYCRLCDIQFNNLSNFITHKKF
YCSSHAAEHVK
Download sequence
Identical sequences F6YLF5
ENSMODP00000006611 XP_001380433.2.35504 ENSMODP00000006611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]