SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000007175 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000007175
Domain Number 1 Region: 293-394
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.95e-23
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.00044
Further Details:      
 
Domain Number 2 Region: 48-114
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000458
Family HLH, helix-loop-helix DNA-binding domain 0.0035
Further Details:      
 
Domain Number 3 Region: 140-216
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000013
Family BphP N-terminal domain-like 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000007175   Gene: ENSMODG00000005798   Transcript: ENSMODT00000007322
Sequence length 846
Comment pep:novel chromosome:BROADO5:X:40919679:41000075:1 gene:ENSMODG00000005798 transcript:ENSMODT00000007322 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQTNPEESLNQEQAGMDTTAEPVQSTSKEAKAPEPGSSKEVTDEVEKDRLKRASRNKSE
KKRRDQFNVLIRELCSMLQGQGEPIKMDKATILQKTIDFLHKQKEKENQAQAAGARGAWK
PSFLSNEEFTQLMFEALDEFLITLTTEGIIIYVSDNVTSLLGHLPSDLVYQNILSLLPEQ
EHKDVYKVLSPQTILPSPVTADFLNEKQIEFSCHLARGRVNPNDPVIYEAVKFFVVFKYL
SRVPIPSSSDFKVVISKTFASPADDPLCLVATVRLNTPQLLKEVCPVEEPGEEFTSRHSL
EWKFLYLDHRAPPIIGYLPFEVLGTSGYDYYHADDLESLARCHKQVMQFGKGKSCYYRFL
TKGQQWIWLQTQYYITYHQWNSKPEFIVCTHTVVSHAQIEAKRRQDLGLEEPSVSEMAVA
PFKNSSSFMDISQCGSSLDMNREAASGSSAHASCRSSLMMPSSSAPELPLQPQEDSATPM
SWNMPLVPPEKTLAEVFSSEVASSSSSSSSSISVRRKSTSTSTSTSTSTSTSCSQGLMFP
QIFNDQLVPYSVNSRKMSMVTCLPEAMSVFPSSKELGPMQQLKDNLEGRTLALQADIEPQ
KPELHTIKGCLQNVQGADFQMILPPPAPMNLKPSKSQKPKKASRRRTKASKTLTKSKLAL
LEPKPFRSSTISSIQFLGEPCIVPHQEPTQQQNAINENEIQEICLPENTRISMPLYGDPM
LYSETYSITVSAEVPIDLIQQPIEYEQDITLGFLQDDRLLPSPSAFTPTTMFIPTTDLAI
VDSQQPGQQWPQPQAPQNDACLQVPAPEPVQENPPSEVFEAPQLLQSSTMSYFLNPQQPN
AELSEI
Download sequence
Identical sequences F6XFA6
ENSMODP00000007175 ENSMODP00000007175

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]