SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000008236 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000008236
Domain Number 1 Region: 407-515
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 8.76e-20
Family Mannose 6-phosphate receptor domain 0.0068
Further Details:      
 
Domain Number 2 Region: 210-260
Classification Level Classification E-value
Superfamily EF-hand 0.000054
Family Polcalcin 0.066
Further Details:      
 
Domain Number 3 Region: 68-108
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000898
Family LDL receptor-like module 0.0048
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000008236
Domain Number - Region: 31-66
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000236
Family LDL receptor-like module 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000008236   Gene: ENSMODG00000006641   Transcript: ENSMODT00000008401
Sequence length 531
Comment pep:novel chromosome:BROADO5:3:429537283:429551963:-1 gene:ENSMODG00000006641 transcript:ENSMODT00000008401 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PLLLLLLLITITAAVEVKRPRGVSLTNHHFYDKSKPFTCLDGSSTIPFDQVNDDYCDCQD
GSDEPGTAACPEGRFHCTNAGYKPHYIPSSRVNDGICDCCDATDEYNSGVVCENTCREMG
RKEKETLEQMAEVAREGFRLKKILIEEGKKGQEEKRDNQIKLLGLQESKKTLEEQVAMLR
AVKEEAEKPEKESKERHQRLWEEQQAAAIAARDQEQAASAFQELDDNTDGVISVAELQTH
PELDPDGDGALSEAEAQAFLGEALQVDAAGFREGLWAAIKDKYQQESLPTMPPLTETTVE
EILETPEEPSPTEDEDEGPGLEEEAEEDEDDEEESPEEDKETLPPQPVKVDEEVEKDKMP
PYDERTQAYIDAAQEARDHFEEAEKSLTEMEESIRNLEQEMALDLGPSGEFSYLFGQCYE
LSTNEYIYRLCPFNRVTQKPNHGGSETNLGTWGSWDASEEEKFHVMHYEHGTGCWQGPNR
STKVKLVCGKETVVTSATEPSRCEYLMELVTPAACQEPPPESAGDPDHDEL
Download sequence
Identical sequences F7G4A4
ENSMODP00000008236 13616.ENSMODP00000008236 ENSMODP00000008236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]