SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000009086 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000009086
Domain Number 1 Region: 8-68
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.96e-28
Family KRAB domain (Kruppel-associated box) 0.00083
Further Details:      
 
Domain Number 2 Region: 357-414
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.37e-27
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 3 Region: 245-302
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.04e-25
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 4 Region: 301-358
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.49e-24
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 5 Region: 399-451
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.86e-21
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 6 Region: 210-259
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000459
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000009086   Gene: ENSMODG00000007331   Transcript: ENSMODT00000009266
Sequence length 453
Comment pep:novel chromosome:BROADO5:1:591329669:591338507:-1 gene:ENSMODG00000007331 transcript:ENSMODT00000009266 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SVDEQKCMFQESVTFKDVAVNFTQEEWEQLNPAQRNLYKDVMLENYQNLISLGLPISKPD
VIFKLEQGKEPWILNLQEAREREVPRNFSPGGWESHLPLSFFHIYLYPLASSFFLMLSRD
YPSLTESWESRSEIQQSPQHENISEESESPGTLVPLNPTFGEIHISEGRLEKHQKNSEQE
KWKKSLSFENTFKQLSINLTESPSKETDLECKECGKKFFDRPSLTRHLRTHKGEKRYKCN
KCGKAFSKHSSLTEHDRLHTGEKPYECDECGKAFSLKSNLTRHQLTHTGEKPYECDECGK
AFSRRSGLMRHHMTHTGESPYKCYECGKAFFNPSSLTEHERIHTGEKPYECDECGKAFSN
QSSLTVHKRIHTGEKPYECDECGKAFSIHSSLTVHQRIHTGEKPYECDECGKAFFDCSSL
IRHQRTHTGEKPYLCSVCGKVFSSKSSVIQHQR
Download sequence
Identical sequences F7EFB2
ENSMODP00000009086 13616.ENSMODP00000009086 ENSMODP00000009086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]