SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000010413 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000010413
Domain Number 1 Region: 28-489
Classification Level Classification E-value
Superfamily Cytochrome P450 1.23e-127
Family Cytochrome P450 0.0000000000207
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000010413   Gene: ENSMODG00000008379   Transcript: ENSMODT00000010615
Sequence length 489
Comment pep:novel chromosome:BROADO5:4:385146562:385172106:-1 gene:ENSMODG00000008379 transcript:ENSMODT00000010615 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNAGDLLLLLAVFLGFLLLLAKRPQKVNLPPGPTPLPLLGNLLQLGRHGLIKSFLECRDK
YGDVFTVYLGTRRYFVICGPESVKKALVDNAEVFSGRGTLAISEMVFQRYGFFVTYDGWK
TLRRVSIATLRDFGMGKRSIEEQIKAEAQCLVEELQKSQGALIDPTFIFHSVTANVICSI
VFGERFSYQDTQFREILNMFVEVFTILSSLWMQFFEQFPSVLKLLPGPHYRVLKIAQHIK
DFISSKIEQHQESLDPNSPRDFIDSFLLRIEKEKETPDSKYHVKNLVLTVLSLFFAGTET
TSTTLRYGFLLLLKYPQVAEKVQEEIDQVVGRDRAPEIKDRAKMPYTDAVIHEIQRFSDL
LPMGIPHMVTEDTSFQGYFLPKGTDVFILLSASLKDPCYFEKPHIFDPNHFLDAQGALKK
NEAFIPFSMGKRACLGEGIARTELFLFFTTILQNFSLVSSKPLEDLDIRPQCSGLGTLPQ
IYKLGFLPR
Download sequence
Identical sequences F7CDT3
ENSMODP00000010413 ENSMODP00000010413 XP_001371957.1.35504 13616.ENSMODP00000010413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]