SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000011291 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000011291
Domain Number 1 Region: 348-443
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 9.56e-16
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.00081
Further Details:      
 
Domain Number 2 Region: 176-227
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000799
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.031
Further Details:      
 
Domain Number 3 Region: 74-123
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000471
Family HLH, helix-loop-helix DNA-binding domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000011291   Gene: ENSMODG00000009053   Transcript: ENSMODT00000011510
Sequence length 669
Comment pep:novel chromosome:BROADO5:4:386061546:386077572:-1 gene:ENSMODG00000009053 transcript:ENSMODT00000011510 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPNYCFLLLLQVPRTLNPAPRSESTQAPARLWGAEMAAPFSGSEVKCVSVEWDFLQGLL
VKAPPVPCLQALRKEKSRNAARSRRGKENFEFYELAKTLPLPSAITSQLDKASIVRLSIT
YLRLRDFAALGDPPWTPPRADLSPAPVSGAPGRRESSAFLTDLFEQHLGGHILQSLDGFV
FALNQEGKFLYISETVSIYLGLSQVELTGSSVFDYVHPGDHSEVLEQLGLKAPPPGPGAP
LYGPSSSSSSSSASSNSEAPETELGPPVLTPRNQPGLLDRSFFIRMKSTLTKRGLHLKAS
GYKVIHVTGRLRTQLLTTRRGQVLGLVALGHTLPPAPLSELPLHGHTLVFRLSLALTIIS
CESRISDYMDVGPSELIGRSCYQFIHGEDVAGVRQSHLDLLDKGQVVTGYYRWLQRAGGF
VWLQSVATVAISGKSPGERHVVWVSYILSQVESSHVVLDAFQLPRTGPQEDLSDPEPEIK
EPKAQVEGEPGAPQPESGARHPRGKRIKLEPARGGGGGGRSSSSSSSSSSQGEAPGGGGE
GGDDSDEEEPSLPAPRPEFTSVIRAGSLKREGLRPWSFAASYPAREPFHRPPSPPDSPSP
PALVHAGYLAPGRGLYTSTIRYGPAELGLALPSPGLVYQHLQRLSGPGPAFPDTLYPSVP
FLGPDRKGD
Download sequence
Identical sequences F7AF98
ENSMODP00000011291 ENSMODP00000011291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]