SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000012520 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000012520
Domain Number 1 Region: 1022-1190
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 6.67e-52
Family BCR-homology GTPase activation domain (BH-domain) 0.0000701
Further Details:      
 
Domain Number 2 Region: 451-662
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.7e-43
Family DBL homology domain (DH-domain) 0.00039
Further Details:      
 
Domain Number 3 Region: 678-747,805-839
Classification Level Classification E-value
Superfamily PH domain-like 1.44e-19
Family Pleckstrin-homology domain (PH domain) 0.025
Further Details:      
 
Domain Number 4 Region: 1-66
Classification Level Classification E-value
Superfamily Bcr-Abl oncoprotein oligomerization domain 1.14e-17
Family Bcr-Abl oncoprotein oligomerization domain 0.00043
Further Details:      
 
Domain Number 5 Region: 882-996
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000000000000536
Family Synaptotagmin-like (S variant) 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000012520   Gene: ENSMODG00000010001   Transcript: ENSMODT00000012748
Sequence length 1238
Comment pep:novel chromosome:BROADO5:2:515510426:515802755:1 gene:ENSMODG00000010001 transcript:ENSMODT00000012748 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWEPADFERHWRAEFPGEPVPAMQLDSVPAMQEELERCKLNLKRLQQVLAEEKFKVIYLQ
TALAREKRGYDCGRWEGGGGEGDSCSSSGPTKEEEEGVEAEEVRAPTELEHPQPRPQPQP
QPRPRSRPQPRPRTRPEPHKEPSSSDSGPGGLASVPRTKSPHYVNLEFPAWRGTPGEGGA
VLSLTAAIHQQLQQPQLLLRPREEQEPELELETERALGNGRRPEGSAQSPSALVSESPGA
SPEEGEELSPAAPEDTEPEALVAAEEGGDSDHDFEVVDLNEKFVLGHLLLAPCRFLPRED
TPEKPLRAGSPHRWLHLIGGKRHRRSRDLDQLEAEGKDGRCSPLPPEEAHFRGAREHLPP
WRRKKLLGVPGRDSPGHSSPERGSDCSYNSSDHEDVSSADFSYGADDYDGEGNEEQKVPP
EGSETMPYIDESPTMSPQLSARSQGSGDGISPTPPEGLGPVVEAGKGLEMRKLVLSGFLA
SEEIYINQLEALLLPMKPLKATATTSQPVLTIQQIETIFYKIQDIYEIHKEFYDNLCPKV
QQWDSQVTLGHLFQKLASQLGVYKAFVDNYKIALETAEKCSQSNNQFQKISEELKVKAPK
DSKDSHTSVTMEALLYKPIDRVTRSTLVLHDLLKHTPVDHPDYPLLQDALRISQNFLSSI
NEDIDPRRTAVTTPKGETRQLVKDGFLVEMAESSRKLRHVFLFTDVLLCAKLKKTSVGKH
QQYDCKWYIPLADLVFPSPEESEPSPQVHPFPDHELEDMKMKISALKSEIQKERASKGQS
RAIERLKKKMFENEFLLLLNSPTIPFRIHNRNGKSYLFLLSSDYERSEWREAIQKLQKKD
LQAFVLSSVELQVLTGSCFKLRTVHNIPVTSNKDDDEAPGLYGFLHVIVHSAKGFKQSAN
LYCTLEVDSFGYFVSKAKTRVFRDTTEPQWNEEFEIELEGSQSLRILCYEKCYDKTKVNK
DNNEIVDKIMGKGQIQLDPQTVQTKNWHMDVIEMNGIKVEFSMKFTSRDMSLKRTPSKKQ
TGVFGVKISVVTKRERSKVPYIVRQCVEEVEKRGIEEIGIYRISGVATDIQALKAVFDAN
NKDVLVMLSDMDINAIAGTLKLYFRELPEPLLTDRLYPAFMEGIALSDPAAKENCMMHLL
RTLPDPNLITFLFLLEHLKRVAEKEPINKMSLHNLATVFGPTLLRPSEVESKGHLTSASD
IWSHDVMAQVQVLLYYLQHPPISFAELKRNTLYFSTDV
Download sequence
Identical sequences F6URY3
ENSMODP00000012520 XP_007485792.1.35504 ENSMODP00000012520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]